PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_82158_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 419aa    MW: 46028.9 Da    PI: 6.5703
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_82158_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP118.72.9e-37206283178
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +Cqv+gC+ad+se+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rr
  cra_locus_82158_iso_1_len_1255_ver_3 206 RCQVPGCDADISELKGYHRRHRVCLRCANASAVVLDGQSKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRR 278
                                           6************************************************************************ PP

                                           -S--- CS
                                   SBP  74 rkkqa 78 
                                           r+k++
  cra_locus_82158_iso_1_len_1255_ver_3 279 RRKAT 283
                                           *9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-29202268IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.051204281IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-34205284IPR004333Transcription factor, SBP-box
PfamPF031102.6E-28207281IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
XPLKATTQPL TLTADLLPPH HLPPPPPPPT ISFSANSSPQ PTPQPPSTNP NHPQPFFTLP  60
LKPIMSNSTP PSTSPPQPSP TIPEMTSVVP DGPSAATTAA PLFEWSDFLD FNFEDPFAAI  120
SFDGDHQEDN PILSSDSKPD SDRVEELSRV RKRDPRLVCS NFLAGRVPCA CPELDEQLEQ  180
EELIVLGGPG KKRARTVRAP AGSTARCQVP GCDADISELK GYHRRHRVCL RCANASAVVL  240
DGQSKRYCQQ CGKFHILSDF DEGKRSCRRK LERHNNRRRR KATDGKGGVE QEAPLTTLSE  300
DISCDDETSK DNTGLGTQLK EKDAIFESEG QVSTHCSAHG SQNTQGDCVG SFAAFGETQI  360
NGGKENPRYD QSPSCCDNKS AFSSMCPTGR ISFKLYDWNP AEFPRRLRHQ IFQWLASMX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-46202289187squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267279RRKLERHNNRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071504.11e-140PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ8S9G81e-101SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A068TSI21e-152A0A068TSI2_COFCA; Uncharacterized protein
STRINGVIT_05s0020g02160.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433